Вину Арумугхам (США)

Роль загрязнения вакцин клеточной культурой куриного эмбриона, содержащей белок аквапорин-4, в этиологии заболеваний оптиконевромиелитического спектра

ResearchGate, Technical Report, August 2017

Перевод Елены Загребельной (Фукуока, Япония)

Для контактов: Vinu Arumugham, Сан-Хосе, Калифорния, США; e-mail vinucube@yahoo.com

Оригинал можно скачать здесь

История вопроса

Была установлена связь аутоиммунной реакции на аквапорин-4 (AQP4) с расстройствами оптиконевромиелитического спектра (NMOSD)1. При изготовлении некоторых вакцин, таких как вакцины против кори, свинки и краснухи (MMR)2 и против клещевого энцефалита, используются клеточные культуры куриных эмбрионов. Мы уже описывали ранее роль загрязнения вакцины MMR клеточной культурой куриных эмбрионов, содержащей глутаматдекарбоксилазу GAD65, в развитии диабета I типа3.

Белок аквапорин-4 экспрессируется во время эмбриогенеза кур4.

Метод

Белковая последовательность человеческого белка аквапорина-4 была получена из базы данных Uniprot5.

Для определения гомологии этого белка с аквапорином-4 вида Gallus gallus (куриным аквапорином-4) была использована программа сравнения баз данных BLASTP6.

Результаты

Как показано ниже, сравнение человеческого и куриного аквапоринов-4 позволяет выявить гомологию последовательностей, составляющую 86%.

PREDICTED: aquaporin-4 isoform X1 [Gallus gallus] XP_015133432.1 323 1

Alignment statistics for match #1

Score Expect Method Identities Positives Gaps

581 bits(1498) 0.0 Compositional matrix adjust. 278/323(86%) 299/323(92%) 0/323(0%)

Query
1
MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWG
60
 
 
MSDR  A R GKC  LC  E+IMVAFKGVWTQ FWKAV+AEFLAMLIFVLLSLGSTINWG
 
Sbjct
1
MSDRAAAPRRGKCARLCKCESIMVAFKGVWTQPFWKAVSAEFLAMLIFVLLSLGSTINWG
60
 
 
 
 
Query
61
GTEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIA
120
 
 
G+EKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKIS+AKSVFYI 
 
Sbjct
61
GSEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISLAKSVFYIL
120
 
 
 
 
Query
121
AQCLGAIIGAGILYLVTPPSVVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDS
180
 
 
AQCLGAI+GAGILYL+TPPSVVGGLGVT VHG+L+AGHGLLVELIITFQLVFTIFASCDS
 
Sbjct
121
AQCLGAIVGAGILYLITPPSVVGGLGVTAVHGDLSAGHGLLVELIITFQLVFTIFASCDS
180
 
 
 
 
Query
181
KRTDVTGSIALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
240
 
 
KR+DVTGS+ALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMG WEN W+YWVGPIIG
 
Sbjct
181
KRSDVTGSVALAIGFSVAIGHLFAINYTGASMNPARSFGPAVIMGKWENQWVYWVGPIIG
240
 
 
 
 
Query
241
AVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH
300
 
 
AVLAG LYEYV+CPD+E KRRFK+ FSKA Q +KG Y+EV+D RS VETDDLILKPG+VH
 
Sbjct
241
AVLAGALYEYVYCPDMELKRRFKDVFSKATQPSKGKYIEVDDTRSHVETDDLILKPGIVH
300
 
 
 
 
Query
301
VIDVDRGEEKKGKDQSGEVLSSV
323
 
 
VID+DR E+KKG+D S EVLSSV
 
Sbjct
301
VIDIDRSEDKKGRDPSSEVLSSV
323

Обсуждение

Вышеприведенные результаты убедительно свидетельствуют о том, что белки из клеточных культур куриных эмбрионов, содержащиеся в вакцинах, могут вызывать выработку антител против куриного аквапорина AQP4. Эти антитела могут вступать в перекрестную реакцию с человеческим аквапорином-4, что приведет к развитию расстройств оптиконевромиелитического спектра. Этот процесс очень похож на тот процесс, посредством которого вакцина пандемрикс вызывает нарколепсию7.

Этот процесс также подобен процессу, который приводит к развитию нервного паралича после введения вакцин, загрязненных нервной тканью эмбрионов кроликов или уток. Описание примеров такого паралича также встречается в литературе8.

Что нужно делать

Для того чтобы избежать подобных катастрофических последствий, следует немедленно взяться за решение фундаментальных проблем, связанных с разработкой и обеспечением безопасности вакцин9.

Ссылки

1  Bennett JL, Lam C, Kalluri SR, Saikali P, Bautista K, Dupree C, et al. Intrathecal pathogenic anti-aquaporin-4 antibodies in early neuromyelitis optica. Ann Neurol. United States; 2009 Nov; 66(5):617–29.
2  MMR II Vaccine Package Insert [Internet]. [cited 2016 May 3].
Available from: http://www.fda.gov/downloads/BiologicsBloodVaccines/Vaccines/ApprovedProducts/UCM1237 89.pdf
3  Arumugham V. Role of MMR II vaccine contamination with GAD65 containing chick embryo cell culture in the etiology of type 1 diabetes. 2017.
4  Nico B, Frigeri A, Nicchia GP, Quondamatteo F, Herken R, Errede M, et al. Role of aquaporin-4 water channel in the development and integrity of the blood-brain barrier. J Cell Sci. England; 2001 Apr; 114 (Pt 7):1297–307.
5  UniProt: the universal protein knowledgebase. Nucleic Acids Res. 2017 Jan 4; 45(D1):D158–69.
6  Altschul SF, Madden TL, Schäffer AA, Zhang J, Zhang Z, Miller W, et al. Gapped BLAST and PSI- BLAST: a new generation of protein database search programs. Nucleic Acids Res. 1997; 25(17):3389–402.
7  Ahmed SS, Volkmuth W, Duca J, Corti L, Pallaoro M, Pezzicoli A, et al. Antibodies to influenza nucleoprotein cross-react with human hypocretin receptor 2 (ABSTRACT ONLY). Sci Transl Med. 2015; 7(294):294ra105–294ra105.
8  Bennetto L, Scolding N. INFLAMMATORY/POST-INFECTIOUS ENCEPHALOMYELITIS. J Neurol Neurosurg Psychiatry. BMJ Publishing Group Ltd; 2004; 75(suppl 1):i22–8.
9  Arumugham V. Flawed assumptions fuel autoimmune disease: The sorry state of vaccine safety science [Internet]. 2017. Available from:
https://www.researchgate.net/publication/318045518_Flawed_assumptions_fuel_autoimmune_disease_ The_sorry_state_of_vaccine_safety_science

Другие материалы о контаминации (загрязнении) вакцин